PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID OB12G25960.1
Common NameLOC102704380
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Oryzoideae; Oryzeae; Oryzinae; Oryza
Family NF-YA
Protein Properties Length: 319aa    MW: 34487.9 Da    PI: 8.3334
Description NF-YA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
OB12G25960.1genomeOGEView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1CBFB_NFYA99.33.8e-31153209158
     CBFB_NFYA   1 deplYVNaKQyqrIlkRRqkRakleeekkldeksrkpylheSRhkhAlrRpRgsgGrF 58 
                   d+p+YVNaKQy +Il+RR++Rak+e+e++l  k rkpylheSRh hA+rR+RgsgGrF
  OB12G25960.1 153 DAPIYVNAKQYAGILRRRHARAKAERENRL-VKDRKPYLHESRHLHAMRRARGSGGRF 209
                   68****************************.**************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005217.1E-35151212IPR001289Nuclear transcription factor Y subunit A
PROSITE profilePS5115236.751152212IPR001289Nuclear transcription factor Y subunit A
PRINTSPR006165.4E-23155177IPR001289Nuclear transcription factor Y subunit A
PfamPF020453.3E-28155209IPR001289Nuclear transcription factor Y subunit A
PROSITE patternPS006860157177IPR018362CCAAT-binding factor, conserved site
PRINTSPR006165.4E-23186209IPR001289Nuclear transcription factor Y subunit A
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0016602Cellular ComponentCCAAT-binding factor complex
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 319 aa     Download sequence    Send to blast
MMSYKSHEGF GQVAAVTSQA SNGGASLSWW AGPQLLFGEP LGQGKPAMSP EGVVPRAQTP  60
LDAPVPPMDR GVPEVLDFSM VPGKGDKGSE HSTTIALQSP FAEYSGCFEL GLGQSVVSSN  120
YPYADQQYGL LSPYGVRPMP SGRILIPPNM PADAPIYVNA KQYAGILRRR HARAKAEREN  180
RLVKDRKPYL HESRHLHAMR RARGSGGRFL NTKKETGGKT TGGGRKAVDI IPPLPAATTP  240
SSEIQHSEQC NRSSVSSLSG SEVTSIYEHE DADHFHSFEH LRTHFFTPLP SIIDVEHGAG  300
NPFIKWAATS DGCCDLLKA
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
4awl_A9e-18153215264NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT ALPHA
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1216223GGKTTGGG
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAB2880320.0AB288032.1 Oryza sativa Japonica Group OsHAP2F mRNA for HAP2 subunit of HAP complex, complete cds.
GenBankAK0737420.0AK073742.1 Oryza sativa Japonica Group cDNA clone:J033067G24, full insert sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015698542.10.0PREDICTED: nuclear transcription factor Y subunit A-10-like
RefseqXP_015698541.10.0PREDICTED: nuclear transcription factor Y subunit A-10-like
RefseqXP_006664212.10.0PREDICTED: nuclear transcription factor Y subunit A-10-like
RefseqXP_015698540.10.0PREDICTED: nuclear transcription factor Y subunit A-10-like
TrEMBLJ3NF380.0J3NF38_ORYBR; Uncharacterized protein
STRINGOB12G25960.10.0(Oryza brachyantha)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP23073790
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G06510.22e-29nuclear factor Y, subunit A10